PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010906053.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 403aa    MW: 45086.3 Da    PI: 6.2408
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010906053.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.15.2e-51541821128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yLkkkv+ +k++l +vi+++d++k+ePwd++   ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  XP_010906053.1  54 VPPGFRFHPTEEELLNYYLKKKVACQKIDL-DVIRDIDLNKLEPWDIQDkcRIGStPQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVI 147
                     69****************************.9***************952433332556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ + + +g++ktLvfy+grap+g k+dW+mheyrl
  XP_010906053.1 148 YT-RFKRIGMRKTLVFYSGRAPHGLKSDWIMHEYRL 182
                     **.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-5749217IPR003441NAC domain
PROSITE profilePS5100555.5754217IPR003441NAC domain
PfamPF023653.1E-2755182IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MSSNNNINIA TWPAPFFPSR CSSSSSNSGY SCLSTCNHMR STDMGISVNG QSCVPPGFRF  60
HPTEEELLNY YLKKKVACQK IDLDVIRDID LNKLEPWDIQ DKCRIGSTPQ NEWYFFSHKD  120
KKYPTGTRTN RATAAGFWKA TGRDKVIYTR FKRIGMRKTL VFYSGRAPHG LKSDWIMHEY  180
RLDDHLDTNT SSSNASSLAG DATTQEEAWV VCRVFKKKSC QTAFANPHSN SSIISNSRTQ  240
LLHSCDGEPL DQILQYLGRS CKQESDAILS IDNNMKNKDY VRPIETALSN MKLPTLESPS  300
LQSLPSFAPE VDPDENKEAI MDMEVVCNSM MAFSDWPSMN EEISGSQIGS GSSEAPKQTP  360
YINEPSFGSP PSNGLFSNSH DCRYGDGDPW SFMQSVSSGS DYM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-505121914167NO APICAL MERISTEM PROTEIN
1ut4_B6e-505121914167NO APICAL MERISTEM PROTEIN
1ut7_A6e-505121914167NO APICAL MERISTEM PROTEIN
1ut7_B6e-505121914167NO APICAL MERISTEM PROTEIN
4dul_A6e-505121914167NAC domain-containing protein 19
4dul_B6e-505121914167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010906053.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-107NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM0SDZ01e-124M0SDZ0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P12230_0011e-124(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.15e-93NAC family protein